PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn321981
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 1696aa    MW: 188194 Da    PI: 6.9102
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn321981genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof72.75.2e-2366112450
      zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvP 50 
                 ++l+cprCdst+t+f yynny+ +qPr+ C +C+r Wt+GG+lr v 
  Achn321981  66 DHLTCPRCDSTDTRFLYYNNYNPAQPRHHCNSCHRAWTRGGTLRRVK 112
                 6789****************************************996 PP

2zf-Dof54.23.1e-17385430348
      zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrn 48 
                 ++ l+cprCdstntkf +y n sl qPr++C +C + Wt+GG++r 
  Achn321981 385 QERLPCPRCDSTNTKFIFYCNKSLYQPRHYCSSCCQSWTQGGTIRS 430
                 68899***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-1561111IPR003851Zinc finger, Dof-type
PfamPF027012.3E-2167114IPR003851Zinc finger, Dof-type
PROSITE profilePS5088421.2568122IPR003851Zinc finger, Dof-type
ProDomPD0074784.0E-13381429IPR003851Zinc finger, Dof-type
PfamPF027012.2E-16386438IPR003851Zinc finger, Dof-type
PROSITE profilePS5088418.492388442IPR003851Zinc finger, Dof-type
PfamPF161354.9E-18917987IPR032308Jas TPL-binding domain
SuperFamilySSF579031.62E-910181057IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.103.3E-1010211057IPR013083Zinc finger, RING/FYVE/PHD-type
SMARTSM002494.8E-510271080IPR001965Zinc finger, PHD-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 1696 aa     Download sequence    Send to blast
MKEGLRSSAK RESGVVSEKD NADSGLNSGE EIASDGENEK RGSDGRGKRG QRVKGGGSYL  60
PEPEPDHLTC PRCDSTDTRF LYYNNYNPAQ PRHHCNSCHR AWTRGGTLRR VKCSWVRVKA  120
REIKGGYENV EQGEGGDVSA DRRIGRGQLG RRIRVNGSGK EGDKVSLCLE EGDETKKTHG  180
NEMQAQAPNS LEDRKIEGGA DKVEHVEDAD VCADEKIGRR GTRRRMVNSS DDEEDVNSGL  240
EDGDGTKNES NNEMQAQVPN SLEDRIFHGG SDNVKQGEDA DVSVDGKIRR GRPGRRRRKV  300
NGSVKEKNEV NSCPKEGDEV ENSGPNLTDP NCVEDSMPFS LESKLEGRRS GREDEHMECN  360
EEAYVNAHGD NHTDTGGKHL PGPNQERLPC PRCDSTNTKF IFYCNKSLYQ PRHYCSSCCQ  420
SWTQGGTIRS YCRPVKKRRV DSSDEVKDEV NSGLEEGDEI KKTDVNNRQG LVPNSLASSQ  480
ERKLEGERNG SEVSEHMECY EESDVITHGD NHTGKPKTGR GKKGRKRKLV EGSVCDGEDG  540
AQIKKVKEAP FGGKTQVVGR ILRSRTAVMG VGEKMVDGEP VGGVDVKKDC DSLSKKVVDM  600
EKDGIARSIG RGKKKFKGRR GRPPKVQGKS DSSCKKVVEM GKDGIAQLFD RGKKKLKGRR  660
GRPPKVQGTN GPQKVIGTKE PKKMGSRENG DQPKSKKVSR DSKFLDNGKH SRRGRHVHHR  720
GQKIIVKQSE WNKQKKGGEL VMRTSTEKQL LRDQIIAMLK NAGWTIEYRP RSGRHYLDSV  780
YVCPQGGSYW SVTLAYRMLK KQVEDGNADG RAISAFTPIP EEEFSKLFRV VSEKKKKRLL  840
EKGLKRQIRA ANEKIKGVIR KKSFIKKLGD SANAMQRGMQ RSNRDGRQNR KRLALLVRDS  900
NKGWDPDSEG FVLYDGKCSL LSWMIDLGTV LDGGKVQYMI HEKTRALLDG KITRDGIHCT  960
CCDEIFDLSD FESHAGCELS QTFQNLYLES GNSLFQCLLD SWRKHEGAEC IGFHPIDIDG  1020
DDPNDDTCNK CGDGGDLICC DSCPSTFHQN CLNIQVFERL QVLLGVKHQL EEGFSCTLVQ  1080
RFDISEDISL SSVPQKVECN SKLAIALSIM DECFLPIVDQ RSGINMMHNV VYSCGIHGNR  1140
LAEMPFIGTR HIYRRQGMCR RLLNAIETAL CSLDVEKLVI PAIAELLQTW TSVFGFMPLE  1200
ESNKKDMEYM NIIVFPGVDM LQKPLLNQKF TEENLISIPA AKSMELITKH QTTHEWASDS  1260
CMDHSAESDL KVSHEVMLDH THGTSDIAAP VESTLLLPDV SLNDACDLPS ETVKLKESVT  1320
IENFLGHSIV THDNQELENK DIKDYEASGV NALELGGQHT TKEINKEENA HSGSTNMTRD  1380
EISKLNRQSV CVLGVQHKLS FDFQTLSDAT NCKGKTLHAK DGTDVSLNAA CDLPKETMKL  1440
KESVTIENCL IHSRVTHDNQ EWKNKDIKDF EASGVDVLEL GGQHATKEMN KEENAHSRSI  1500
NVPSDEISKL NQLGVLGVEP KLSYDFQTVC NATNCEGNTL HANDDPDVSL NGTCDLPSET  1560
VKSRESVTIE NSLDHSGVTH DNPAWENKNI KDAIELCGQH TTKEINKEEN APSGSTNVIH  1620
DEVSKLNQLS ALGVEHKLSC VSQTVSDATN CGMGKARHAK EGPDCQLNGE VDTANFICQD  1680
SASTNLIHSD VQCRT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1521528KKGRKRKL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.19e-19Dof family protein